Property prediction · Sequence prediction
NetSolP API
Predict whether a protein will be soluble and usable when expressed in E. coli.
Runs NetSolP over a set of FASTA sequences, scoring each for solubility and for usability, which combines solubility with expressibility. The predictions come from a protein language model and need no structure.
Request body
Fields
The same names the web form posts. See the field type table for what each kind means over HTTP.
| Name | Type | Required | Default | Description |
|---|---|---|---|---|
job_name
|
string text | no | netsolp-demo |
Job name |
fasta
|
string file | yes | >demo_protein
MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG |
Sequences (FASTA) One or more records. Each is scored independently. file types .fasta,.fa,.faa,.txt. |
model_type
|
string select | no | ESM12 |
Model
One of:
ESM12, ESM1b, Distilled.
|
prediction_type
|
string select | no | SU |
Prediction
One of:
S, U, SU.
|
Example
A request that runs
These are the defaults, exactly as the web form would post them.
curl -X POST https://athanortools.com/api/netsolp/ \
-H 'Content-Type: application/json' \
-d '{
"job_name": "netsolp-demo",
"fasta": ">demo_protein\nMKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG",
"model_type": "ESM12",
"prediction_type": "SU"
}'
The reply is 202 with a queued job; poll its
status_url until status is
succeeded or failed. See
the quick start for the
whole exchange.
Responses
What comes back
| status | Meaning |
|---|---|
queued |
Accepted, waiting for the jobs ahead of it. `position` counts how many those are. |
running |
The tool is executing now. |
succeeded |
Finished; `result` holds the tool's output and `license` the terms it came under. |
failed |
Finished; `error` holds a code and a message. |
cancelled |
Abandoned at the submitter's request; there is no result. A job cancelled before its turn never ran at all. |
Errors
| code | Meaning |
|---|---|
invalid_input |
The client supplied invalid or incomplete input. |
tool_unavailable |
The requested third-party dependency is not available on this host. |
execution_failed |
A configured third-party tool exited unsuccessfully. |
internal_error |
An adapter failed in a way it does not describe. The detail is in the server log, not the response. |
not_found |
No job has that id. Finished jobs are dropped eventually. |