← API reference
Property prediction · Cheminformatics

DLKcat API

Predict an enzyme turnover number from its sequence and a substrate structure.

Runs the deep-learning half of the DLKcat toolbox, which pairs a graph neural network over the substrate with a convolutional network over the enzyme sequence to predict kcat. It is trained on wild-type and mutant enzymes across many organisms, and is meant for parameterising models rather than for ranking closely related variants.

Request body

Fields

The same names the web form posts. See the field type table for what each kind means over HTTP.

Name Type Required Default Description
job_name string text no dlkcat-demo Job name
protein_sequence string textarea yes MSEPAQKKQKVSNGGGSSNKRAADSLADQLYGKSAAAAHTPPAKKAKTETIAAPTFTTSGLDKLDLSNIDSSAWKQLAEEDLASLYGDLD … Enzyme sequence
substrate_smiles string textarea yes OCC1OC(O)C(O)C(O)C1O Substrate SMILES The substrate as a SMILES string; DLKcat builds its molecular graph from this.
substrate_name string text no D-glucose Substrate name Carried through to the output for readability; it does not affect the prediction.
additional_entries string textarea no Additional pairs (optional) More substrate/enzyme pairs to score in the same run, one per line, as name;SMILES;sequence.
Example

A request that runs

These are the defaults, exactly as the web form would post them.

curl -X POST https://athanortools.com/api/dlkcat/ \
  -H 'Content-Type: application/json' \
  -d '{
  "job_name": "dlkcat-demo",
  "protein_sequence": "MSEPAQKKQKVSNGGGSSNKRAADSLADQLYGKSAAAAHTPPAKKAKTETIAAPTFTTSGLDKLDLSNIDSSAWKQLAEEDLASLYGDLDSHRLDQPFPSAAAPVAKKRVSFTDSAAAA",
  "substrate_smiles": "OCC1OC(O)C(O)C(O)C1O",
  "substrate_name": "D-glucose",
  "additional_entries": ""
}'

The reply is 202 with a queued job; poll its status_url until status is succeeded or failed. See the quick start for the whole exchange.

Responses

What comes back

statusMeaning
queued Accepted, waiting for the jobs ahead of it. `position` counts how many those are.
running The tool is executing now.
succeeded Finished; `result` holds the tool's output and `license` the terms it came under.
failed Finished; `error` holds a code and a message.
cancelled Abandoned at the submitter's request; there is no result. A job cancelled before its turn never ran at all.

Errors

codeMeaning
invalid_input The client supplied invalid or incomplete input.
tool_unavailable The requested third-party dependency is not available on this host.
execution_failed A configured third-party tool exited unsuccessfully.
internal_error An adapter failed in a way it does not describe. The detail is in the server log, not the response.
not_found No job has that id. Finished jobs are dropped eventually.