Property prediction

DeepSTABp API

Predict the melting temperature of a protein from its sequence.

Runs DeepSTABp, which embeds each sequence with a protein language model and predicts the melting temperature it would show in a thermal proteome profiling experiment, conditioned on the growth temperature and on whether the measurement is on cells or lysate.

Web form Examples ↗ Home page ↗ Paper ↗ Source code ↗ License ↗

Submit POST /api/deepstabp/

Queues a run and returns 202 with the job.

Schema GET /api/deepstabp/

Returns this tool's metadata and the fields below, as JSON.

Example presets

Send {"preset": "single_sequence"} to load an example and its bundled inputs. Add other request fields to override its settings. The schema includes all presets under tool.presets.

preset	Description
`single_sequence`	Official DeepSTABp web example: One raw amino-acid sequence. Source ↗
`multiple_sequences`	Official DeepSTABp web example: Two raw sequences separated by >!. Source ↗
`single_fasta`	Official DeepSTABp web example: One named FASTA record. Source ↗

Request body

Fields

The same names the web form posts. See the field type table for what each kind means over HTTP.

Name	Type	Required	Default	Description
`job_name`	string text	no	`deepstabp-demo`	Job name
`fasta`	string file	yes	`>demo_protein MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG`	Protein sequences FASTA, one raw amino-acid sequence, or multiple raw sequences separated by >!. Each is predicted independently. file types .fasta,.fa,.faa,.txt.
`growth_temperature`	number number	no	`37.0`	Growth temperature (C) The temperature the organism was cultured at, which the model conditions on. minimum -20, maximum 110, step 0.5.
`measurement_condition`	string select	no	`lysate`	Measurement condition One of: `lysate`, `cell`.

Example

A request that runs

These are the defaults, exactly as the web form would post them.

curl -X POST https://athanortools.com/api/deepstabp/ \
  -H 'Content-Type: application/json' \
  -d '{
  "job_name": "deepstabp-demo",
  "fasta": ">demo_protein\nMKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG",
  "growth_temperature": 37.0,
  "measurement_condition": "lysate"
}'

The reply is 202 with a queued job; poll its status_url until status is succeeded or failed. See the quick start for the whole exchange.

Responses

What comes back

status	Meaning
`queued`	Accepted, waiting for the jobs ahead of it. `position` counts how many those are.
`running`	The tool is executing now.
`succeeded`	Finished; `result` holds the tool's output and `license` the terms it came under.
`failed`	Finished; `error` holds a code and a message.
`cancelled`	Abandoned at the submitter's request; there is no result. A job cancelled before its turn never ran at all.

Errors

code	Meaning
`invalid_input`	The client supplied invalid or incomplete input.
`tool_unavailable`	The requested third-party dependency is not available on this host.
`execution_failed`	A configured third-party tool exited unsuccessfully.
`internal_error`	An adapter failed in a way it does not describe. The detail is in the server log, not the response.
`not_found`	No job has that id. Finished jobs are dropped eventually.