← API reference
Sequence analysis · Antibody design

Antibody Annotator API

Number an antibody or TCR sequence and report its regions and liabilities.

Numbers each variable domain with the chosen scheme, reports the framework and CDR boundaries that follow from it, and flags the sequence motifs associated with glycosylation, deamidation, isomerisation, and oxidation in each region.

Request body

Fields

The same names the web form posts. See the field type table for what each kind means over HTTP.

Name Type Required Default Description
job_name string text no annotator-demo Job name
fasta string file yes >heavy EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQM … Sequences (FASTA) One record per chain. Variable domains only; constant regions are not numbered. file types .fasta,.fa,.faa,.txt.
numbering_scheme string select no imgt Numbering scheme One of: imgt, kabat, chothia, martin, aho.
receptor_type string select no antibody Receptor type One of: antibody, tcr, shark, unknown.
report_liabilities boolean checkbox no true Report sequence liabilities
Example

A request that runs

These are the defaults, exactly as the web form would post them.

curl -X POST https://athanortools.com/api/antibody_annotator/ \
  -H 'Content-Type: application/json' \
  -d '{
  "job_name": "annotator-demo",
  "fasta": ">heavy\nEVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSS\n>light\nDIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIK",
  "numbering_scheme": "imgt",
  "receptor_type": "antibody",
  "report_liabilities": true
}'

The reply is 202 with a queued job; poll its status_url until status is succeeded or failed. See the quick start for the whole exchange.

Responses

What comes back

statusMeaning
queued Accepted, waiting for the jobs ahead of it. `position` counts how many those are.
running The tool is executing now.
succeeded Finished; `result` holds the tool's output and `license` the terms it came under.
failed Finished; `error` holds a code and a message.
cancelled Abandoned at the submitter's request; there is no result. A job cancelled before its turn never ran at all.

Errors

codeMeaning
invalid_input The client supplied invalid or incomplete input.
tool_unavailable The requested third-party dependency is not available on this host.
execution_failed A configured third-party tool exited unsuccessfully.
internal_error An adapter failed in a way it does not describe. The detail is in the server log, not the response.
not_found No job has that id. Finished jobs are dropped eventually.